BEND6 polyclonal antibody
  • BEND6 polyclonal antibody

BEND6 polyclonal antibody

Ref: AB-PAB22567
BEND6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BEND6.
Información adicional
Size 100 uL
Gene Name BEND6
Gene Alias C6orf65|FLJ30162|bA203B9.1
Gene Description BEN domain containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSSPDSFASTCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BEND6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221336
Iso type IgG

Enviar un mensaje


BEND6 polyclonal antibody

BEND6 polyclonal antibody