KIAA1429 polyclonal antibody
  • KIAA1429 polyclonal antibody

KIAA1429 polyclonal antibody

Ref: AB-PAB22563
KIAA1429 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1429.
Información adicional
Size 100 uL
Gene Name KIAA1429
Gene Alias DKFZp434I116|DKFZp781B2117|MGC138493|MGC141940|MSTP054|fSAP121
Gene Description KIAA1429
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVALNTRKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1429.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25962
Iso type IgG

Enviar un mensaje


KIAA1429 polyclonal antibody

KIAA1429 polyclonal antibody