C2orf30 polyclonal antibody
  • C2orf30 polyclonal antibody

C2orf30 polyclonal antibody

Ref: AB-PAB22559
C2orf30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf30.
Información adicional
Size 100 uL
Gene Name C2orf30
Gene Alias CL24936|CL25084|ERLECTIN|XTP3-B|XTP3TPB
Gene Description chromosome 2 open reading frame 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27248
Iso type IgG

Enviar un mensaje


C2orf30 polyclonal antibody

C2orf30 polyclonal antibody