BROX polyclonal antibody
  • BROX polyclonal antibody

BROX polyclonal antibody

Ref: AB-PAB22555
BROX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BROX.
Información adicional
Size 100 uL
Gene Name BROX
Gene Alias Brox|FLJ32421|MGC142195|MGC142197|RP11-452F19.1
Gene Description chromosome 1 open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BROX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 148362
Iso type IgG

Enviar un mensaje


BROX polyclonal antibody

BROX polyclonal antibody