KRTAP25-1 polyclonal antibody
  • KRTAP25-1 polyclonal antibody

KRTAP25-1 polyclonal antibody

Ref: AB-PAB22553
KRTAP25-1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KRTAP25-1.
Información adicional
Size 100 uL
Gene Name KRTAP25-1
Gene Alias KAP25.1
Gene Description keratin associated protein 25-1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MHNRSQGFFFSSCHPQNHVSYGCQSPSFIFCRCQSLNFVSRTCYPLSYFSYGNQTIGSISNSFRSLNYVSHSFQPISFMHSSFQPACSDFVGWQSPFLRRTC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KRTAP25-1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100131902
Iso type IgG

Enviar un mensaje


KRTAP25-1 polyclonal antibody

KRTAP25-1 polyclonal antibody