RMND1 polyclonal antibody
  • RMND1 polyclonal antibody

RMND1 polyclonal antibody

Ref: AB-PAB22548
RMND1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RMND1.
Información adicional
Size 100 uL
Gene Name RMND1
Gene Alias C6orf96|FLJ20627|MGC117362|MGC149570|MGC88260|RMD1|bA351K16|bA351K16.3
Gene Description required for meiotic nuclear division 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RMND1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55005
Iso type IgG

Enviar un mensaje


RMND1 polyclonal antibody

RMND1 polyclonal antibody