CLSTN2 polyclonal antibody
  • CLSTN2 polyclonal antibody

CLSTN2 polyclonal antibody

Ref: AB-PAB22543
CLSTN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLSTN2.
Información adicional
Size 100 uL
Gene Name CLSTN2
Gene Alias ALC-GAMMA|CS2|CSTN2|FLJ39113|FLJ39499|MGC119560|alcagamma
Gene Description calsyntenin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLSTN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64084
Iso type IgG

Enviar un mensaje


CLSTN2 polyclonal antibody

CLSTN2 polyclonal antibody