CLCN4 polyclonal antibody
  • CLCN4 polyclonal antibody

CLCN4 polyclonal antibody

Ref: AB-PAB22540
CLCN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLCN4.
Información adicional
Size 100 uL
Gene Name CLCN4
Gene Alias CLC4|ClC-4|ClC-4A|MGC163150
Gene Description chloride channel 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLCN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1183
Iso type IgG

Enviar un mensaje


CLCN4 polyclonal antibody

CLCN4 polyclonal antibody