MOSPD1 polyclonal antibody
  • MOSPD1 polyclonal antibody

MOSPD1 polyclonal antibody

Ref: AB-PAB22522
MOSPD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MOSPD1.
Información adicional
Size 100 uL
Gene Name MOSPD1
Gene Alias DJ473B4
Gene Description motile sperm domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MOSPD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56180
Iso type IgG

Enviar un mensaje


MOSPD1 polyclonal antibody

MOSPD1 polyclonal antibody