WDR23 polyclonal antibody
  • WDR23 polyclonal antibody

WDR23 polyclonal antibody

Ref: AB-PAB22521
WDR23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR23.
Información adicional
Size 100 uL
Gene Name WDR23
Gene Alias DKFZp779A1629|GL014|PRO2389
Gene Description WD repeat domain 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80344
Iso type IgG

Enviar un mensaje


WDR23 polyclonal antibody

WDR23 polyclonal antibody