KCNV2 polyclonal antibody
  • KCNV2 polyclonal antibody

KCNV2 polyclonal antibody

Ref: AB-PAB22517
KCNV2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNV2.
Información adicional
Size 100 uL
Gene Name KCNV2
Gene Alias KV11.1|Kv8.2|MGC120515|RCD3B
Gene Description potassium channel, subfamily V, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNV2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 169522
Iso type IgG

Enviar un mensaje


KCNV2 polyclonal antibody

KCNV2 polyclonal antibody