ZC3H15 polyclonal antibody
  • ZC3H15 polyclonal antibody

ZC3H15 polyclonal antibody

Ref: AB-PAB22511
ZC3H15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZC3H15.
Información adicional
Size 100 uL
Gene Name ZC3H15
Gene Alias HT010|LEREPO4|MSTP012
Gene Description zinc finger CCCH-type containing 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCKFSHDLTLERKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZC3H15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55854
Iso type IgG

Enviar un mensaje


ZC3H15 polyclonal antibody

ZC3H15 polyclonal antibody