TXNIP polyclonal antibody
  • TXNIP polyclonal antibody

TXNIP polyclonal antibody

Ref: AB-PAB22506
TXNIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNIP.
Información adicional
Size 100 uL
Gene Name TXNIP
Gene Alias EST01027|HHCPA78|THIF|VDUP1
Gene Description thioredoxin interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNIP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10628
Iso type IgG

Enviar un mensaje


TXNIP polyclonal antibody

TXNIP polyclonal antibody