KCNJ8 polyclonal antibody
  • KCNJ8 polyclonal antibody

KCNJ8 polyclonal antibody

Ref: AB-PAB22503
KCNJ8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNJ8.
Información adicional
Size 100 uL
Gene Name KCNJ8
Gene Alias KIR6.1|uKATP-1
Gene Description potassium inwardly-rectifying channel, subfamily J, member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNJ8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3764
Iso type IgG

Enviar un mensaje


KCNJ8 polyclonal antibody

KCNJ8 polyclonal antibody