VTA1 polyclonal antibody
  • VTA1 polyclonal antibody

VTA1 polyclonal antibody

Ref: AB-PAB22500
VTA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VTA1.
Información adicional
Size 100 uL
Gene Name VTA1
Gene Alias C6orf55|DRG-1|DRG1|FLJ27228|HSPC228|LIP5|My012|SBP1
Gene Description Vps20-associated 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VTA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51534
Iso type IgG

Enviar un mensaje


VTA1 polyclonal antibody

VTA1 polyclonal antibody