ZNF354C polyclonal antibody
  • ZNF354C polyclonal antibody

ZNF354C polyclonal antibody

Ref: AB-PAB22499
ZNF354C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF354C.
Información adicional
Size 100 uL
Gene Name ZNF354C
Gene Alias KID3
Gene Description zinc finger protein 354C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF354C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 30832
Iso type IgG

Enviar un mensaje


ZNF354C polyclonal antibody

ZNF354C polyclonal antibody