hCG_1776007 polyclonal antibody
  • hCG_1776007 polyclonal antibody

hCG_1776007 polyclonal antibody

Ref: AB-PAB22488
hCG_1776007 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant hCG_1776007.
Información adicional
Size 100 uL
Gene Name hCG_1776007
Gene Alias FLJ56884|FLJ58356|FOX3|HRNBP3
Gene Description hexaribonucleotide binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human hCG_1776007.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146713
Iso type IgG

Enviar un mensaje


hCG_1776007 polyclonal antibody

hCG_1776007 polyclonal antibody