SLC25A29 polyclonal antibody
  • SLC25A29 polyclonal antibody

SLC25A29 polyclonal antibody

Ref: AB-PAB22485
SLC25A29 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC25A29.
Información adicional
Size 100 uL
Gene Name SLC25A29
Gene Alias C14orf69|CACL|FLJ38975
Gene Description solute carrier family 25, member 29
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HDSPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQDAGPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDRLLVPKLLLAGGTSGIVSWLSTYPVDVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC25A29.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 123096
Iso type IgG

Enviar un mensaje


SLC25A29 polyclonal antibody

SLC25A29 polyclonal antibody