OGT polyclonal antibody
  • OGT polyclonal antibody

OGT polyclonal antibody

Ref: AB-PAB22483
OGT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OGT.
Información adicional
Size 100 uL
Gene Name OGT
Gene Alias FLJ23071|HRNT1|MGC22921|O-GLCNAC
Gene Description O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OGT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8473
Iso type IgG

Enviar un mensaje


OGT polyclonal antibody

OGT polyclonal antibody