TM7SF2 polyclonal antibody
  • TM7SF2 polyclonal antibody

TM7SF2 polyclonal antibody

Ref: AB-PAB22480
TM7SF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TM7SF2.
Información adicional
Size 100 uL
Gene Name TM7SF2
Gene Alias ANG1|DHCR14A
Gene Description transmembrane 7 superfamily member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QVAPVSALAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TM7SF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7108
Iso type IgG

Enviar un mensaje


TM7SF2 polyclonal antibody

TM7SF2 polyclonal antibody