LACE1 polyclonal antibody
  • LACE1 polyclonal antibody

LACE1 polyclonal antibody

Ref: AB-PAB22475
LACE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LACE1.
Información adicional
Size 100 uL
Gene Name LACE1
Gene Alias AFG1
Gene Description lactation elevated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TFEELCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFLHQHHDSELEQSRILMDDLGLSQDSAEGLSMFTG
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LACE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 246269
Iso type IgG

Enviar un mensaje


LACE1 polyclonal antibody

LACE1 polyclonal antibody