SBK2 polyclonal antibody
  • SBK2 polyclonal antibody

SBK2 polyclonal antibody

Ref: AB-PAB22471
SBK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SBK2.
Información adicional
Size 100 uL
Gene Name SBK2
Gene Alias -
Gene Description SH3-binding domain kinase family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAPAADALLRGLLDPHPRRRSAVIAIWEHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SBK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 646643
Iso type IgG

Enviar un mensaje


SBK2 polyclonal antibody

SBK2 polyclonal antibody