C6orf62 polyclonal antibody
  • C6orf62 polyclonal antibody

C6orf62 polyclonal antibody

Ref: AB-PAB22463
C6orf62 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf62.
Información adicional
Size 100 uL
Gene Name C6orf62
Gene Alias DKFZp564G182|FLJ12619|Nbla00237|XTP12|dJ30M3.2
Gene Description chromosome 6 open reading frame 62
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQLTHWAVGTIEDHLRPYMPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf62.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81688
Iso type IgG

Enviar un mensaje


C6orf62 polyclonal antibody

C6orf62 polyclonal antibody