SLC39A2 polyclonal antibody
  • SLC39A2 polyclonal antibody

SLC39A2 polyclonal antibody

Ref: AB-PAB22455
SLC39A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC39A2.
Información adicional
Size 100 uL
Gene Name SLC39A2
Gene Alias MGC119190|ZIP2
Gene Description solute carrier family 39 (zinc transporter), member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC39A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29986
Iso type IgG

Enviar un mensaje


SLC39A2 polyclonal antibody

SLC39A2 polyclonal antibody