RPTN polyclonal antibody
  • RPTN polyclonal antibody

RPTN polyclonal antibody

Ref: AB-PAB22453
RPTN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPTN.
Información adicional
Size 100 uL
Gene Name RPTN
Gene Alias FLJ39117
Gene Description repetin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KSGSYCGQSERLGQELGCGQTDRQGQSSHYGQTDRQDQSYHYGQTDRQGQSSHYSQTDRQGQSSHYSQPDRQGQSSHYGQMD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPTN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126638
Iso type IgG

Enviar un mensaje


RPTN polyclonal antibody

RPTN polyclonal antibody