SLC35D3 polyclonal antibody
  • SLC35D3 polyclonal antibody

SLC35D3 polyclonal antibody

Ref: AB-PAB22447
SLC35D3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC35D3.
Información adicional
Size 100 uL
Gene Name SLC35D3
Gene Alias FRCL1|MGC102873|bA55K22.3
Gene Description solute carrier family 35, member D3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC35D3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340146
Iso type IgG

Enviar un mensaje


SLC35D3 polyclonal antibody

SLC35D3 polyclonal antibody