FAM167A polyclonal antibody
  • FAM167A polyclonal antibody

FAM167A polyclonal antibody

Ref: AB-PAB22446
FAM167A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM167A.
Información adicional
Size 100 uL
Gene Name FAM167A
Gene Alias C8orf13|D8S265|DKFZp761G151|MGC120649|MGC120650|MGC120651
Gene Description family with sequence similarity 167, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GQEPLLPLREAGQHPPSARSASQGARPLSSGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM167A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83648
Iso type IgG

Enviar un mensaje


FAM167A polyclonal antibody

FAM167A polyclonal antibody