KCMF1 polyclonal antibody
  • KCMF1 polyclonal antibody

KCMF1 polyclonal antibody

Ref: AB-PAB22441
KCMF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCMF1.
Información adicional
Size 100 uL
Gene Name KCMF1
Gene Alias DEBT91|DKFZp434L1021|FIGC|PCMF|ZZZ1
Gene Description potassium channel modulatory factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCMF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56888
Iso type IgG

Enviar un mensaje


KCMF1 polyclonal antibody

KCMF1 polyclonal antibody