ZYG11A polyclonal antibody
  • ZYG11A polyclonal antibody

ZYG11A polyclonal antibody

Ref: AB-PAB22439
100 uL

Información del producto

ZYG11A polyclonal antibody
Información adicional
Size 100 uL
Gene Name ZYG11A
Gene Alias ZYG11
Gene Description zyg-11 homolog A (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HADLPVPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQLTGLRILSVFNVCFHTEDLANVSQLPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZYG11A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 440590
Iso type IgG

Enviar un mensaje


ZYG11A polyclonal antibody

ZYG11A polyclonal antibody