LYRM4 polyclonal antibody
  • LYRM4 polyclonal antibody

LYRM4 polyclonal antibody

Ref: AB-PAB22438
LYRM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LYRM4.
Información adicional
Size 100 uL
Gene Name LYRM4
Gene Alias C6orf149|CGI-203|ISD11
Gene Description LYR motif containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq RAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LYRM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57128
Iso type IgG

Enviar un mensaje


LYRM4 polyclonal antibody

LYRM4 polyclonal antibody