PM20D2 polyclonal antibody
  • PM20D2 polyclonal antibody

PM20D2 polyclonal antibody

Ref: AB-PAB22433
PM20D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PM20D2.
Información adicional
Size 100 uL
Gene Name PM20D2
Gene Alias ACY1L2|bA63L7.3
Gene Description peptidase M20 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKLQEEQFVN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PM20D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135293
Iso type IgG

Enviar un mensaje


PM20D2 polyclonal antibody

PM20D2 polyclonal antibody