UFD1L polyclonal antibody
  • UFD1L polyclonal antibody

UFD1L polyclonal antibody

Ref: AB-PAB22428
UFD1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UFD1L.
Información adicional
Size 100 uL
Gene Name UFD1L
Gene Alias UFD1
Gene Description ubiquitin fusion degradation 1 like (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UFD1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7353
Iso type IgG

Enviar un mensaje


UFD1L polyclonal antibody

UFD1L polyclonal antibody