MTO1 polyclonal antibody
  • MTO1 polyclonal antibody

MTO1 polyclonal antibody

Ref: AB-PAB22422
MTO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTO1.
Información adicional
Size 100 uL
Gene Name MTO1
Gene Alias CGI-02
Gene Description mitochondrial translation optimization 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGPAVWGLRAQIDRKLYKQNMQKEILNTPLLTVQEGAVEDLILTEPEPEHTGKCRVSGVVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25821
Iso type IgG

Enviar un mensaje


MTO1 polyclonal antibody

MTO1 polyclonal antibody