KIAA1009 polyclonal antibody
  • KIAA1009 polyclonal antibody

KIAA1009 polyclonal antibody

Ref: AB-PAB22410
KIAA1009 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1009.
Información adicional
Size 100 uL
Gene Name KIAA1009
Gene Alias C6orf84|FLJ13551|QN1
Gene Description KIAA1009
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVKKNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1009.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22832
Iso type IgG

Enviar un mensaje


KIAA1009 polyclonal antibody

KIAA1009 polyclonal antibody