TJAP1 polyclonal antibody
  • TJAP1 polyclonal antibody

TJAP1 polyclonal antibody

Ref: AB-PAB22407
TJAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TJAP1.
Información adicional
Size 100 uL
Gene Name TJAP1
Gene Alias DKFZp686F06131|PILT|TJP4
Gene Description tight junction associated protein 1 (peripheral)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TJAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93643
Iso type IgG

Enviar un mensaje


TJAP1 polyclonal antibody

TJAP1 polyclonal antibody