HSPB11 polyclonal antibody
  • HSPB11 polyclonal antibody

HSPB11 polyclonal antibody

Ref: AB-PAB22398
HSPB11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HSPB11.
Información adicional
Size 100 uL
Gene Name HSPB11
Gene Alias C1orf41|HSPCO34|PP25
Gene Description heat shock protein family B (small), member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HSPB11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51668
Iso type IgG

Enviar un mensaje


HSPB11 polyclonal antibody

HSPB11 polyclonal antibody