ANKRD44 polyclonal antibody
  • ANKRD44 polyclonal antibody

ANKRD44 polyclonal antibody

Ref: AB-PAB22395
ANKRD44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD44.
Información adicional
Size 100 uL
Gene Name ANKRD44
Gene Alias MGC21968|MGC70444
Gene Description ankyrin repeat domain 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91526
Iso type IgG

Enviar un mensaje


ANKRD44 polyclonal antibody

ANKRD44 polyclonal antibody