RWDD2A polyclonal antibody
  • RWDD2A polyclonal antibody

RWDD2A polyclonal antibody

Ref: AB-PAB22391
RWDD2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RWDD2A.
Información adicional
Size 100 uL
Gene Name RWDD2A
Gene Alias MGC13523|MGC138208|RWDD2|dJ747H23.2
Gene Description RWD domain containing 2A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QLLLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKLVYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RWDD2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 112611
Iso type IgG

Enviar un mensaje


RWDD2A polyclonal antibody

RWDD2A polyclonal antibody