RNF187 polyclonal antibody
  • RNF187 polyclonal antibody

RNF187 polyclonal antibody

Ref: AB-PAB22386
RNF187 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF187.
Información adicional
Size 100 uL
Gene Name RNF187
Gene Alias -
Gene Description ring finger protein 187
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF187.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149603
Iso type IgG

Enviar un mensaje


RNF187 polyclonal antibody

RNF187 polyclonal antibody