KCTD20 polyclonal antibody
  • KCTD20 polyclonal antibody

KCTD20 polyclonal antibody

Ref: AB-PAB22385
KCTD20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCTD20.
Información adicional
Size 100 uL
Gene Name KCTD20
Gene Alias C6orf69|MGC14254|dJ108K11.3
Gene Description potassium channel tetramerisation domain containing 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCTD20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222658
Iso type IgG

Enviar un mensaje


KCTD20 polyclonal antibody

KCTD20 polyclonal antibody