SMYD4 polyclonal antibody
  • SMYD4 polyclonal antibody

SMYD4 polyclonal antibody

Ref: AB-PAB22377
SMYD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMYD4.
Información adicional
Size 100 uL
Gene Name SMYD4
Gene Alias KIAA1936|ZMYND21
Gene Description SET and MYND domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ACQTEAHRMAAGPRWEAFCCNSCGAPMQGDDVLRCGSRSCAESAVSRDHLVSRLQDLQQQVRVAQKLLRDGELERAVQRLSGCQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMYD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114826
Iso type IgG

Enviar un mensaje


SMYD4 polyclonal antibody

SMYD4 polyclonal antibody