FAM176C polyclonal antibody
  • FAM176C polyclonal antibody

FAM176C polyclonal antibody

Ref: AB-PAB22373
FAM176C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM176C.
Información adicional
Size 100 uL
Gene Name FAM176C
Gene Alias PRED34|B18|B19|C21orf63|C21orf64|EVA-1|EVA1|SUE21
Gene Description family with sequence similarity 176, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM176C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 59271
Iso type IgG

Enviar un mensaje


FAM176C polyclonal antibody

FAM176C polyclonal antibody