FAM185A polyclonal antibody
  • FAM185A polyclonal antibody

FAM185A polyclonal antibody

Ref: AB-PAB22362
FAM185A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM185A.
Información adicional
Size 100 uL
Gene Name FAM185A
Gene Alias MGC35361
Gene Description family with sequence similarity 185, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM185A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222234
Iso type IgG

Enviar un mensaje


FAM185A polyclonal antibody

FAM185A polyclonal antibody