NKAIN4 polyclonal antibody
  • NKAIN4 polyclonal antibody

NKAIN4 polyclonal antibody

Ref: AB-PAB22361
NKAIN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NKAIN4.
Información adicional
Size 100 uL
Gene Name NKAIN4
Gene Alias C20orf58|FAM77A|bA261N11.2
Gene Description Na+/K+ transporting ATPase interacting 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVY
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NKAIN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128414
Iso type IgG

Enviar un mensaje


NKAIN4 polyclonal antibody

NKAIN4 polyclonal antibody