CAGE1 polyclonal antibody
  • CAGE1 polyclonal antibody

CAGE1 polyclonal antibody

Ref: AB-PAB22355
CAGE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CAGE1.
Información adicional
Size 100 uL
Gene Name CAGE1
Gene Alias CTAG3|FLJ40441|bA69L16.7
Gene Description cancer antigen 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DNNIENYSTNALIQPVDTISISSLRQFETVCKFHWVEAFDDEMTEKPEFQSQVYNYAKDNNIKQDSFKEENPMETSVSANTDQLGNEYF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CAGE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285782
Iso type IgG

Enviar un mensaje


CAGE1 polyclonal antibody

CAGE1 polyclonal antibody