TTI2 polyclonal antibody
  • TTI2 polyclonal antibody

TTI2 polyclonal antibody

Ref: AB-PAB22351
TTI2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTI2.
Información adicional
Size 100 uL
Gene Name TTI2
Gene Alias C8orf41
Gene Description TELO2 interacting protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QEDSNLSEELSHSAFGQAFSKILHCLARPEARRGNVKDAVLKDLGDLIEATGFDRLFEGTGARLRGMPETLGQVAKALEKY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTI2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80185
Iso type IgG

Enviar un mensaje


TTI2 polyclonal antibody

TTI2 polyclonal antibody