C14orf94 polyclonal antibody
  • C14orf94 polyclonal antibody

C14orf94 polyclonal antibody

Ref: AB-PAB22349
C14orf94 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf94.
Información adicional
Size 100 uL
Gene Name C14orf94
Gene Alias FLJ20424
Gene Description chromosome 14 open reading frame 94
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf94.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54930
Iso type IgG

Enviar un mensaje


C14orf94 polyclonal antibody

C14orf94 polyclonal antibody