FAM54A polyclonal antibody
  • FAM54A polyclonal antibody

FAM54A polyclonal antibody

Ref: AB-PAB22345
FAM54A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM54A.
Información adicional
Size 100 uL
Gene Name FAM54A
Gene Alias DUFD1
Gene Description family with sequence similarity 54, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LILNILREMLEYFGVPVEQVLLIWENKDYGSTRSIVRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCGSMVPSFADILYVANDEEASYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM54A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 113115
Iso type IgG

Enviar un mensaje


FAM54A polyclonal antibody

FAM54A polyclonal antibody