C6orf118 polyclonal antibody
  • C6orf118 polyclonal antibody

C6orf118 polyclonal antibody

Ref: AB-PAB22343
C6orf118 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf118.
Información adicional
Size 100 uL
Gene Name C6orf118
Gene Alias MGC23884|bA85G2.1|dJ416F21.2
Gene Description chromosome 6 open reading frame 118
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLCNLKKLLNRLQKDHREDVYLYISGHLNPNKLYQPPETILQHWPNAHRPKGERASEVGEPPAGKVARMKEALAHFTIHTALVPSEAQDTPLFRYLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf118.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 168090
Iso type IgG

Enviar un mensaje


C6orf118 polyclonal antibody

C6orf118 polyclonal antibody