ZNF660 polyclonal antibody
  • ZNF660 polyclonal antibody

ZNF660 polyclonal antibody

Ref: AB-PAB22333
ZNF660 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF660.
Información adicional
Size 100 uL
Gene Name ZNF660
Gene Alias FLJ36870
Gene Description zinc finger protein 660
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYVCTECGKAFSQSANLTVHERIHTGEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF660.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285349
Iso type IgG

Enviar un mensaje


ZNF660 polyclonal antibody

ZNF660 polyclonal antibody